![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily) alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta; |
![]() | Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) ![]() some topological similarity to ribosomal protein L22 automatically mapped to Pfam PF01196 |
![]() | Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein) |
![]() | Protein Prokaryotic ribosomal protein L17 [64265] (4 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [160268] (6 PDB entries) Uniprot Q9RSJ5 3-115 |
![]() | Domain d1xbpl1: 1xbp L:3-115 [145877] Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 automatically matched to 2ZJR K:3-115 complexed with mul |
PDB Entry: 1xbp (more details), 3.5 Å
SCOPe Domain Sequences for d1xbpl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbpl1 d.188.1.1 (L:3-115) Prokaryotic ribosomal protein L17 {Deinococcus radiodurans [TaxId: 1299]} hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmaliel
Timeline for d1xbpl1:
![]() Domains from other chains: (mouse over for more information) d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 |