Lineage for d1xbpj1 (1xbp J:4-144)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835020Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 1835021Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 1835022Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 1835023Protein Ribosomal protein L15 (L15p) [52082] (4 species)
  7. 1835024Species Deinococcus radiodurans [TaxId:1299] [159455] (6 PDB entries)
    Uniprot Q9RSK9 4-144
  8. 1835030Domain d1xbpj1: 1xbp J:4-144 [145876]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR I:4-144
    complexed with mul

Details for d1xbpj1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (J:) 50S ribosomal protein L15

SCOPe Domain Sequences for d1xbpj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpj1 c.12.1.1 (J:4-144) Ribosomal protein L15 (L15p) {Deinococcus radiodurans [TaxId: 1299]}
hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
aasaaaikaveaaggrvvlpe

SCOPe Domain Coordinates for d1xbpj1:

Click to download the PDB-style file with coordinates for d1xbpj1.
(The format of our PDB-style files is described here.)

Timeline for d1xbpj1: