SCOPe 2.02: Domain d1xbpj1: 1xbp J:4-144

Lineage for d1xbpj1 (1xbp J:4-144)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
   core: three turns of irregular (beta-beta-alpha)n superhelix

4. Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family)

5. Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)

6. Protein Ribosomal protein L15 (L15p) [52082] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159455] (6 PDB entries)
   Uniprot Q9RSK9 4-144

8. Domain d1xbpj1: 1xbp J:4-144 [145876]
   Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
   automatically matched to 2ZJR I:4-144
   complexed with mul

Details for d1xbpj1

PDB Entry: 1xbp, 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin

PDB Compounds: (J:) 50S ribosomal protein L15

SCOPe Domain Sequences for d1xbpj1:

Sequence; same for both SEQRES and ATOM records:

>d1xbpj1 c.12.1.1 (J:4-144) Ribosomal protein L15 (L15p) {Deinococcus radiodurans [TaxId: 1299]}
hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
aasaaaikaveaaggrvvlpe

Timeline for d1xbpj1:

• d1xbpj1 first appeared in SCOP 1.75
  
• d1xbpj1 appears in SCOPe 2.01
  
• d1xbpj1 appears in SCOPe 2.03
  
• d1xbpj1 appears in the current release, SCOPe 2.08