SCOP 1.75: Domain d1xbpi1: 1xbp I:2-133

Lineage for d1xbpi1 (1xbp I:2-133)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159079] (6 PDB entries)
   Uniprot Q9RXJ2 1-134

8. Domain d1xbpi1: 1xbp I:2-133 [145875]
   Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
   automatically matched to 2ZJR H:1-134
   complexed with mul

Details for d1xbpi1

PDB Entry: 1xbp, 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin

PDB Compounds: (I:) 50S ribosomal protein L14

SCOP Domain Sequences for d1xbpi1:

Sequence; same for both SEQRES and ATOM records:

>d1xbpi1 b.39.1.1 (I:2-133) Ribosomal protein L14 {Deinococcus radiodurans [TaxId: 1299]}
impqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaapr
gavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrdr
rfmkivslapev

Timeline for d1xbpi1:

• d1xbpi1 is new in SCOP 1.75
  
• d1xbpi1 appears in SCOPe 2.01
  
• d1xbpi1 appears in the current release, SCOPe 2.08