Lineage for d1xbph1 (1xbp H:30-171)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463497Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 2463498Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 2463499Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 2463500Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 2463501Species Deinococcus radiodurans [TaxId:1299] [159475] (6 PDB entries)
    Uniprot Q9RXY1 30-171
  8. 2463507Domain d1xbph1: 1xbp H:30-171 [145874]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR G:30-171
    complexed with mul

Details for d1xbph1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (H:) 50S ribosomal protein L13

SCOPe Domain Sequences for d1xbph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbph1 c.21.1.1 (H:30-171) Ribosomal protein L13 {Deinococcus radiodurans [TaxId: 1299]}
ktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqva
ltgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrlk
vyagethphsaqkpqvlktqpl

SCOPe Domain Coordinates for d1xbph1:

Click to download the PDB-style file with coordinates for d1xbph1.
(The format of our PDB-style files is described here.)

Timeline for d1xbph1: