Lineage for d1xbpg2 (1xbp G:1-71)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411943Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 1411944Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 1411945Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 1411949Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 1411950Species Deinococcus radiodurans [TaxId:1299] [160199] (4 PDB entries)
    Uniprot Q9RSS7 1-71
  8. 1411954Domain d1xbpg2: 1xbp G:1-71 [145873]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJQ F:1-71
    complexed with mul

Details for d1xbpg2

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (G:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1xbpg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpg2 d.47.1.1 (G:1-71) Ribosomal protein L11, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
adrsftfitkt

SCOPe Domain Coordinates for d1xbpg2:

Click to download the PDB-style file with coordinates for d1xbpg2.
(The format of our PDB-style files is described here.)

Timeline for d1xbpg2: