Lineage for d1xbpg1 (1xbp G:72-143)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723435Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1723436Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1723437Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1723450Species Deinococcus radiodurans [TaxId:1299] [158348] (4 PDB entries)
    Uniprot Q9RSS7 72-144
  8. 1723454Domain d1xbpg1: 1xbp G:72-143 [145872]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJQ F:72-144
    complexed with mul

Details for d1xbpg1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (G:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1xbpg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpg1 a.4.7.1 (G:72-143) Ribosomal protein L11, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
ppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsveaaantvagta
rsmgvtveggpn

SCOPe Domain Coordinates for d1xbpg1:

Click to download the PDB-style file with coordinates for d1xbpg1.
(The format of our PDB-style files is described here.)

Timeline for d1xbpg1: