Lineage for d1xbpe2 (1xbp E:5-82)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217079Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 2217080Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 2217081Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 2217082Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 2217086Species Deinococcus radiodurans [TaxId:1299] [160798] (6 PDB entries)
    Uniprot Q9RSL3 8-82! Uniprot Q9RSL3 83-172
  8. 2217098Domain d1xbpe2: 1xbp E:5-82 [145871]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR E:5-82
    complexed with mul

Details for d1xbpe2

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (E:) 50S ribosomal protein L6

SCOPe Domain Sequences for d1xbpe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpe2 d.141.1.1 (E:5-82) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]}
gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
hgltrtlvanavkgvsdg

SCOPe Domain Coordinates for d1xbpe2:

Click to download the PDB-style file with coordinates for d1xbpe2.
(The format of our PDB-style files is described here.)

Timeline for d1xbpe2: