SCOPe 2.05: Domain d1xbpe1: 1xbp E:83-172

Lineage for d1xbpe1 (1xbp E:83-172)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Deinococcus radiodurans [TaxId:1299] [160798] (6 PDB entries)
   Uniprot Q9RSL3 8-82! Uniprot Q9RSL3 83-172

8. Domain d1xbpe1: 1xbp E:83-172 [145870]
   Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
   automatically matched to 2ZJR E:83-172
   complexed with mul

Details for d1xbpe1

PDB Entry: 1xbp, 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin

PDB Compounds: (E:) 50S ribosomal protein L6

SCOPe Domain Sequences for d1xbpe1:

Sequence; same for both SEQRES and ATOM records:

>d1xbpe1 d.141.1.1 (E:83-172) Ribosomal protein L6 {Deinococcus radiodurans [TaxId: 1299]}
ytinlelrgvgfrakltgkalemnigyshpviieppagvtfavpeptridvsgidkqlvg
qvaanvrkvrkpdayhgkgvrfvgeqialk

Timeline for d1xbpe1:

• d1xbpe1 first appeared in SCOP 1.75
  
• d1xbpe1 appears in SCOPe 2.04
  
• d1xbpe1 appears in SCOPe 2.06
  
• d1xbpe1 appears in the current release, SCOPe 2.08