Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.77: RL5-like [55281] (1 superfamily) beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654 |
Superfamily d.77.1: RL5-like [55282] (3 families) |
Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein) |
Protein Ribosomal protein L5 [55284] (5 species) synonym: 50S ribosomal protein L5p, HMAL5, HL13 |
Species Deinococcus radiodurans [TaxId:1299] [160487] (6 PDB entries) Uniprot Q9RXJ0 3-179 |
Domain d1xbpd1: 1xbp D:3-179 [145869] Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 automatically matched to 2ZJR D:3-179 complexed with mul |
PDB Entry: 1xbp (more details), 3.5 Å
SCOPe Domain Sequences for d1xbpd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbpd1 d.77.1.1 (D:3-179) Ribosomal protein L5 {Deinococcus radiodurans [TaxId: 1299]} qlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalitl qkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpnaf dgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk
Timeline for d1xbpd1:
View in 3D Domains from other chains: (mouse over for more information) d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1 |