Lineage for d1xbpd1 (1xbp D:3-179)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865505Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 865506Superfamily d.77.1: RL5-like [55282] (2 families) (S)
  5. 865507Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 865508Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 865553Species Deinococcus radiodurans [TaxId:1299] [160487] (6 PDB entries)
    Uniprot Q9RXJ0 3-179
  8. 865555Domain d1xbpd1: 1xbp D:3-179 [145869]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR D:3-179
    complexed with mul

Details for d1xbpd1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (D:) 50S ribosomal protein L5

SCOP Domain Sequences for d1xbpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpd1 d.77.1.1 (D:3-179) Ribosomal protein L5 {Deinococcus radiodurans [TaxId: 1299]}
qlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalitl
qkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpnaf
dgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk

SCOP Domain Coordinates for d1xbpd1:

Click to download the PDB-style file with coordinates for d1xbpd1.
(The format of our PDB-style files is described here.)

Timeline for d1xbpd1: