SCOP 1.75: Domain d1xbpc1: 1xbp C:2-198

Lineage for d1xbpc1 (1xbp C:2-198)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.22: Ribosomal protein L4 [52165] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family)

5. Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein)

6. Protein Ribosomal protein L4 [52168] (5 species)
   synonym: 50S ribosomal protein L4e, HMAL4, HL6

7. Species Deinococcus radiodurans [TaxId:1299] [159478] (6 PDB entries)
   Uniprot Q9RXK1 2-198

8. Domain d1xbpc1: 1xbp C:2-198 [145868]
   Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
   automatically matched to 2ZJR C:2-198
   complexed with mul

Details for d1xbpc1

PDB Entry: 1xbp, 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin

PDB Compounds: (C:) 50S ribosomal protein L4

SCOP Domain Sequences for d1xbpc1:

Sequence; same for both SEQRES and ATOM records:

>d1xbpc1 c.22.1.1 (C:2-198) Ribosomal protein L4 {Deinococcus radiodurans [TaxId: 1299]}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

Timeline for d1xbpc1:

• d1xbpc1 is new in SCOP 1.75
  
• d1xbpc1 appears in SCOPe 2.01
  
• d1xbpc1 appears in the current release, SCOPe 2.08