Lineage for d1xbpb1 (1xbp B:1-205)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126671Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1126691Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 1126852Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
  6. 1126853Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 1126854Species Deinococcus radiodurans [TaxId:1299] [159160] (9 PDB entries)
    Uniprot Q9RXK2 1-205
  8. 1126863Domain d1xbpb1: 1xbp B:1-205 [145867]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR B:1-205
    complexed with mul

Details for d1xbpb1

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (B:) 50S ribosomal protein L3

SCOPe Domain Sequences for d1xbpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpb1 b.43.3.2 (B:1-205) Ribosomal protein L3 {Deinococcus radiodurans [TaxId: 1299]}
mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
lilvkgaipgangglvvlrsaakas

SCOPe Domain Coordinates for d1xbpb1:

Click to download the PDB-style file with coordinates for d1xbpb1.
(The format of our PDB-style files is described here.)

Timeline for d1xbpb1: