Lineage for d1xbpa2 (1xbp A:33-127)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 799829Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 799875Species Deinococcus radiodurans [TaxId:1299] [159085] (5 PDB entries)
    Uniprot Q9RXJ9 33-127
  8. 799877Domain d1xbpa2: 1xbp A:33-127 [145866]
    Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR A:33-127
    complexed with mul

Details for d1xbpa2

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (A:) 50S ribosomal protein L2

SCOP Domain Sequences for d1xbpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbpa2 b.40.4.5 (A:33-127) N-terminal domain of ribosomal protein L2 {Deinococcus radiodurans [TaxId: 1299]}
ltealpktggrnnrgritsrfiggghkrlyriidfkrrdksgvnakvaaieydpnrsari
allhyadgekryilapegltvgatvnagpeaepkl

SCOP Domain Coordinates for d1xbpa2:

Click to download the PDB-style file with coordinates for d1xbpa2.
(The format of our PDB-style files is described here.)

Timeline for d1xbpa2: