SCOPe 2.05: Domain d1xbpa1: 1xbp A:128-272

Lineage for d1xbpa1 (1xbp A:128-272)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159028] (5 PDB entries)
   Uniprot Q9RXJ9 128-272

8. Domain d1xbpa1: 1xbp A:128-272 [145865]
   Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp31, d1xbp41, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
   automatically matched to 2ZJR A:128-272
   complexed with mul

Details for d1xbpa1

PDB Entry: 1xbp, 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin

PDB Compounds: (A:) 50S ribosomal protein L2

SCOPe Domain Sequences for d1xbpa1:

Sequence; same for both SEQRES and ATOM records:

>d1xbpa1 b.34.5.3 (A:128-272) C-terminal domain of ribosomal protein L2 {Deinococcus radiodurans [TaxId: 1299]}
gnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelrrvhs
ecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgagrvpv
tpwgkptkglktrrkrktsdrfivt

Timeline for d1xbpa1:

• d1xbpa1 first appeared in SCOP 1.75
  
• d1xbpa1 appears in SCOPe 2.04
  
• d1xbpa1 appears in SCOPe 2.06
  
• d1xbpa1 appears in the current release, SCOPe 2.08