SCOPe 2.04: Domain d1xbp31: 1xbp 3:2-64

Lineage for d1xbp31 (1xbp 3:2-64)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.301: L35p-like [143033] (1 superfamily)
   core: alpha-beta(3)-alpha; 2layers a/b

4. Superfamily d.301.1: L35p-like [143034] (1 family)
   automatically mapped to Pfam PF01632

5. Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
   Pfam PF01632

6. Protein Ribosomal protein L35p [143036] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [160056] (6 PDB entries)
   Uniprot Q9RSW6 2-64

8. Domain d1xbp31: 1xbp 3:2-64 [145863]
   Other proteins in same PDB: d1xbp11, d1xbp21, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
   automatically matched to 2ZJR 3:2-64
   complexed with mul

Details for d1xbp31

PDB Entry: 1xbp, 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin

PDB Compounds: (3:) 50S ribosomal protein L35

SCOPe Domain Sequences for d1xbp31:

Sequence; same for both SEQRES and ATOM records:

>d1xbp31 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

Timeline for d1xbp31:

• d1xbp31 first appeared in SCOP 1.75
  
• d1xbp31 appears in SCOPe 2.03
  
• d1xbp31 appears in SCOPe 2.05
  
• d1xbp31 appears in the current release, SCOPe 2.08