Lineage for d1xbp21 (1xbp 2:1-46)

  1. Root: SCOPe 2.05
  2. 1973804Class j: Peptides [58231] (129 folds)
  3. 1975611Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 1975612Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 1975613Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 1975614Protein Ribosomal protein L34p [144323] (3 species)
  7. 1975615Species Deinococcus radiodurans [TaxId:1299] [161305] (6 PDB entries)
    Uniprot Q9RSH2 1-46
  8. 1975621Domain d1xbp21: 1xbp 2:1-46 [145862]
    Other proteins in same PDB: d1xbp11, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR 2:1-46
    complexed with mul

Details for d1xbp21

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (2:) 50S ribosomal protein L34

SCOPe Domain Sequences for d1xbp21:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbp21 j.118.1.1 (2:1-46) Ribosomal protein L34p {Deinococcus radiodurans [TaxId: 1299]}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

SCOPe Domain Coordinates for d1xbp21:

Click to download the PDB-style file with coordinates for d1xbp21.
(The format of our PDB-style files is described here.)

Timeline for d1xbp21: