Lineage for d1xbp11 (1xbp 1:2-54)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244855Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1245344Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1245545Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein)
    Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members
  6. 1245546Protein Ribosomal protein L33p [144204] (3 species)
  7. 1245547Species Deinococcus radiodurans [TaxId:1299] [161179] (6 PDB entries)
    Uniprot Q9RSS4 2-54
  8. 1245553Domain d1xbp11: 1xbp 1:2-54 [145861]
    Other proteins in same PDB: d1xbp21, d1xbp31, d1xbp41, d1xbpa1, d1xbpa2, d1xbpb1, d1xbpc1, d1xbpd1, d1xbpe1, d1xbpe2, d1xbpg1, d1xbpg2, d1xbph1, d1xbpi1, d1xbpj1, d1xbpl1, d1xbpm1, d1xbpn1, d1xbpo1, d1xbpp1, d1xbpq1, d1xbpr1, d1xbps1, d1xbpt1, d1xbpu1, d1xbpw1, d1xbpx1, d1xbpz1
    automatically matched to 2ZJR 1:2-54
    complexed with mul

Details for d1xbp11

PDB Entry: 1xbp (more details), 3.5 Å

PDB Description: Inhibition of peptide bond formation by pleuromutilins: The structure of the 50S ribosomal subunit from Deinococcus radiodurans in complex with Tiamulin
PDB Compounds: (1:) 50S ribosomal protein L33

SCOPe Domain Sequences for d1xbp11:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbp11 g.41.8.6 (1:2-54) Ribosomal protein L33p {Deinococcus radiodurans [TaxId: 1299]}
akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk

SCOPe Domain Coordinates for d1xbp11:

Click to download the PDB-style file with coordinates for d1xbp11.
(The format of our PDB-style files is described here.)

Timeline for d1xbp11: