Lineage for d1x93b_ (1x93 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712590Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 2712591Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 2712633Family a.43.1.3: CopG-like [100970] (4 proteins)
    similar to the phage repressor family
  6. 2712683Protein Uncharacterized protein HP0222 [158480] (1 species)
  7. 2712684Species Helicobacter pylori [TaxId:210] [158481] (1 PDB entry)
    Uniprot O25010 31-73
  8. 2712686Domain d1x93b_: 1x93 B: [145860]
    automated match to d1x93a1

Details for d1x93b_

PDB Entry: 1x93 (more details)

PDB Description: NMR Structure of Helicobacter pylori HP0222
PDB Compounds: (B:) hypothetical protein HP0222

SCOPe Domain Sequences for d1x93b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x93b_ a.43.1.3 (B:) Uncharacterized protein HP0222 {Helicobacter pylori [TaxId: 210]}
travslyfsdeqyqklekmaneeeesvgsyikryilkalrkie

SCOPe Domain Coordinates for d1x93b_:

Click to download the PDB-style file with coordinates for d1x93b_.
(The format of our PDB-style files is described here.)

Timeline for d1x93b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x93a1