| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.43: Ribbon-helix-helix [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Ribbon-helix-helix [47598] (12 families) ![]() formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon |
| Family a.43.1.3: CopG-like [100970] (4 proteins) similar to the phage repressor family |
| Protein Uncharacterized protein HP0222 [158480] (1 species) |
| Species Helicobacter pylori [TaxId:210] [158481] (1 PDB entry) Uniprot O25010 31-73 |
| Domain d1x93a1: 1x93 A:31-73 [145859] |
PDB Entry: 1x93 (more details)
SCOPe Domain Sequences for d1x93a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x93a1 a.43.1.3 (A:31-73) Uncharacterized protein HP0222 {Helicobacter pylori [TaxId: 210]}
travslyfsdeqyqklekmaneeeesvgsyikryilkalrkie
Timeline for d1x93a1: