Lineage for d1x8dd1 (1x8d D:1-104)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861406Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 861659Family d.58.4.21: YiiL-like [160298] (1 protein)
    Pfam PF05336; DUF718
  6. 861660Protein L-rhamnose mutarotase YiiL [160299] (1 species)
  7. 861661Species Escherichia coli [TaxId:562] [160300] (1 PDB entry)
    Uniprot P32156 1-104
  8. 861665Domain d1x8dd1: 1x8d D:1-104 [145858]
    automatically matched to 1X8D A:1-104
    complexed with rns

Details for d1x8dd1

PDB Entry: 1x8d (more details), 1.8 Å

PDB Description: crystal structure of e. coli yiil protein containing l-rhamnose
PDB Compounds: (D:) Hypothetical protein yiiL

SCOP Domain Sequences for d1x8dd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8dd1 d.58.4.21 (D:1-104) L-rhamnose mutarotase YiiL {Escherichia coli [TaxId: 562]}
mirkafvmqvnpdaheeyqrrhnpiwpeleavlkshgahnyaiyldkarnllfamveies
eerwnavastdvcqrwwkymtdvmpanpdnspvsselqevfylp

SCOP Domain Coordinates for d1x8dd1:

Click to download the PDB-style file with coordinates for d1x8dd1.
(The format of our PDB-style files is described here.)

Timeline for d1x8dd1: