SCOP 1.75: Domain d1x8da1: 1x8d A:1-104

Lineage for d1x8da1 (1x8d A:1-104)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.21: YiiL-like [160298] (1 protein)
   Pfam PF05336; DUF718

6. Protein L-rhamnose mutarotase YiiL [160299] (1 species)

7. Species Escherichia coli [TaxId:562] [160300] (1 PDB entry)
   Uniprot P32156 1-104

8. Domain d1x8da1: 1x8d A:1-104 [145855]
   complexed with rns

Details for d1x8da1

PDB Entry: 1x8d, 1.8 Å

PDB Description: crystal structure of e. coli yiil protein containing l-rhamnose

PDB Compounds: (A:) Hypothetical protein yiiL

SCOP Domain Sequences for d1x8da1:

Sequence; same for both SEQRES and ATOM records:

>d1x8da1 d.58.4.21 (A:1-104) L-rhamnose mutarotase YiiL {Escherichia coli [TaxId: 562]}
mirkafvmqvnpdaheeyqrrhnpiwpeleavlkshgahnyaiyldkarnllfamveies
eerwnavastdvcqrwwkymtdvmpanpdnspvsselqevfylp

Timeline for d1x8da1:

• d1x8da1 is new in SCOP 1.75
  
• d1x8da1 appears in SCOPe 2.01
  
• d1x8da1 appears in the current release, SCOPe 2.08