Lineage for d1x52a1 (1x52 A:8-118)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 865651Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 865875Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 865984Family d.79.3.2: ERF1/Dom34 C-terminal domain-like [55323] (3 proteins)
  6. 865988Protein Cell division protein pelota [160506] (2 species)
  7. 865989Species Human (Homo sapiens) [TaxId:9606] [160507] (1 PDB entry)
    Uniprot Q9BRX2 261-371
  8. 865990Domain d1x52a1: 1x52 A:8-118 [145854]

Details for d1x52a1

PDB Entry: 1x52 (more details)

PDB Description: solution structures of the c-terminal domain of the human pelota homolog (cgi-17)
PDB Compounds: (A:) Pelota homolog

SCOP Domain Sequences for d1x52a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]}
tvasrlsdtkaagevkalddfykmlqhepdrafyglkqvekaneamaidtllisdelfrh
qdvatrsryvrlvdsvkenagtvrifsslhvsgeqlsqltgvaailrfpvp

SCOP Domain Coordinates for d1x52a1:

Click to download the PDB-style file with coordinates for d1x52a1.
(The format of our PDB-style files is described here.)

Timeline for d1x52a1: