Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (3 families) |
Family d.79.3.2: ERF1/Dom34 C-terminal domain-like [55323] (3 proteins) |
Protein Cell division protein pelota [160506] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [160507] (1 PDB entry) Uniprot Q9BRX2 261-371 |
Domain d1x52a1: 1x52 A:8-118 [145854] |
PDB Entry: 1x52 (more details)
SCOP Domain Sequences for d1x52a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]} tvasrlsdtkaagevkalddfykmlqhepdrafyglkqvekaneamaidtllisdelfrh qdvatrsryvrlvdsvkenagtvrifsslhvsgeqlsqltgvaailrfpvp
Timeline for d1x52a1: