Lineage for d1x52a1 (1x52 A:8-118)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525848Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2525957Family d.79.3.2: ERF1/Dom34 C-terminal domain-like [55323] (3 proteins)
    automatically mapped to Pfam PF03465
  6. 2525961Protein Cell division protein pelota [160506] (2 species)
  7. 2525962Species Human (Homo sapiens) [TaxId:9606] [160507] (1 PDB entry)
    Uniprot Q9BRX2 261-371
  8. 2525963Domain d1x52a1: 1x52 A:8-118 [145854]
    Other proteins in same PDB: d1x52a2, d1x52a3

Details for d1x52a1

PDB Entry: 1x52 (more details)

PDB Description: Solution structures of the C-terminal domain of the human Pelota homolog (CGI-17)
PDB Compounds: (A:) Pelota homolog

SCOPe Domain Sequences for d1x52a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]}
tvasrlsdtkaagevkalddfykmlqhepdrafyglkqvekaneamaidtllisdelfrh
qdvatrsryvrlvdsvkenagtvrifsslhvsgeqlsqltgvaailrfpvp

SCOPe Domain Coordinates for d1x52a1:

Click to download the PDB-style file with coordinates for d1x52a1.
(The format of our PDB-style files is described here.)

Timeline for d1x52a1: