Lineage for d1x4pa1 (1x4p A:8-60)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737712Fold a.217: Surp module (SWAP domain) [109904] (1 superfamily)
    5 helices: irregular array
  4. 2737713Superfamily a.217.1: Surp module (SWAP domain) [109905] (1 family) (S)
  5. 2737714Family a.217.1.1: Surp module (SWAP domain) [109906] (3 proteins)
    Pfam PF01805
  6. 2737715Protein Arginine/serine-rich-splicing factor 14 [158610] (1 species)
  7. 2737716Species Human (Homo sapiens) [TaxId:9606] [158611] (1 PDB entry)
    Uniprot Q8IX01 587-639
  8. 2737717Domain d1x4pa1: 1x4p A:8-60 [145853]
    Other proteins in same PDB: d1x4pa2, d1x4pa3

Details for d1x4pa1

PDB Entry: 1x4p (more details)

PDB Description: solution structure of surp domain in sfrs14 protei
PDB Compounds: (A:) Putative splicing factor, arginine/serine-rich 14

SCOPe Domain Sequences for d1x4pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4pa1 a.217.1.1 (A:8-60) Arginine/serine-rich-splicing factor 14 {Human (Homo sapiens) [TaxId: 9606]}
vgtidqlvkrviegslspkertllkedpaywflsdensleykyyklklaemqr

SCOPe Domain Coordinates for d1x4pa1:

Click to download the PDB-style file with coordinates for d1x4pa1.
(The format of our PDB-style files is described here.)

Timeline for d1x4pa1: