Lineage for d1x4oa1 (1x4o A:8-72)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737712Fold a.217: Surp module (SWAP domain) [109904] (1 superfamily)
    5 helices: irregular array
  4. 2737713Superfamily a.217.1: Surp module (SWAP domain) [109905] (1 family) (S)
  5. 2737714Family a.217.1.1: Surp module (SWAP domain) [109906] (3 proteins)
    Pfam PF01805
  6. 2737722Protein Splicing factor 4 [109907] (1 species)
  7. 2737723Species Mouse (Mus musculus) [TaxId:10090] [109908] (2 PDB entries)
    Uniprot Q8CH02 165-239
  8. 2737724Domain d1x4oa1: 1x4o A:8-72 [145852]
    Other proteins in same PDB: d1x4oa2, d1x4oa3
    2nd SURP domain

Details for d1x4oa1

PDB Entry: 1x4o (more details)

PDB Description: solution structure of surp domain in splicing factor 4
PDB Compounds: (A:) splicing factor 4

SCOPe Domain Sequences for d1x4oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x4oa1 a.217.1.1 (A:8-72) Splicing factor 4 {Mouse (Mus musculus) [TaxId: 10090]}
kvsppedeeaknlaeklarfiadggpevetialqnnrenqafsflydpnsqgyryyrqkl
defrk

SCOPe Domain Coordinates for d1x4oa1:

Click to download the PDB-style file with coordinates for d1x4oa1.
(The format of our PDB-style files is described here.)

Timeline for d1x4oa1: