Lineage for d1x2hc2 (1x2h C:1-246)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1036802Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1036803Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 1037057Family d.104.1.3: LplA-like [143642] (6 proteins)
    part of Pfam PF03099
  6. 1037074Protein Two-domain LplA, N-terminal domain [160607] (1 species)
  7. 1037075Species Escherichia coli [TaxId:562] [160608] (2 PDB entries)
    Uniprot P32099 1-246
  8. 1037081Domain d1x2hc2: 1x2h C:1-246 [145851]
    Other proteins in same PDB: d1x2ha1, d1x2hb1, d1x2hc1
    automatically matched to 1X2G A:1-246
    complexed with lpa

Details for d1x2hc2

PDB Entry: 1x2h (more details), 2.91 Å

PDB Description: crystal structure of lipate-protein ligase a from escherichia coli complexed with lipoic acid
PDB Compounds: (C:) Lipoate-protein ligase A

SCOPe Domain Sequences for d1x2hc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2hc2 d.104.1.3 (C:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
wewnfg

SCOPe Domain Coordinates for d1x2hc2:

Click to download the PDB-style file with coordinates for d1x2hc2.
(The format of our PDB-style files is described here.)

Timeline for d1x2hc2: