Lineage for d1x2hc1 (1x2h C:247-337)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613577Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2613578Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2613645Family d.224.1.3: SP1160 C-terminal domain-like [143216] (2 proteins)
    automatically mapped to Pfam PF10437
  6. 2613649Protein Two-domain LplA, C-terminal domain [160211] (1 species)
  7. 2613650Species Escherichia coli [TaxId:562] [160212] (5 PDB entries)
    Uniprot P32099 247-337
  8. 2613659Domain d1x2hc1: 1x2h C:247-337 [145850]
    Other proteins in same PDB: d1x2ha2, d1x2hb2, d1x2hc2
    automated match to d1x2ga1
    complexed with lpa

Details for d1x2hc1

PDB Entry: 1x2h (more details), 2.91 Å

PDB Description: crystal structure of lipate-protein ligase a from escherichia coli complexed with lipoic acid
PDB Compounds: (C:) Lipoate-protein ligase A

SCOPe Domain Sequences for d1x2hc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2hc1 d.224.1.3 (C:247-337) Two-domain LplA, C-terminal domain {Escherichia coli [TaxId: 562]}
qapafshllderftwggvelhfdvekghitraqvftdslnpaplealagrlqgclyradm
lqqeceallvdfpeqekelrelsawmagavr

SCOPe Domain Coordinates for d1x2hc1:

Click to download the PDB-style file with coordinates for d1x2hc1.
(The format of our PDB-style files is described here.)

Timeline for d1x2hc1: