![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.3: LplA-like [143642] (6 proteins) part of Pfam PF03099 |
![]() | Protein Two-domain LplA, N-terminal domain [160607] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [160608] (5 PDB entries) Uniprot P32099 1-246 |
![]() | Domain d1x2ha2: 1x2h A:1-246 [145847] Other proteins in same PDB: d1x2ha1, d1x2hb1, d1x2hc1 automated match to d1x2ga2 complexed with lpa |
PDB Entry: 1x2h (more details), 2.91 Å
SCOPe Domain Sequences for d1x2ha2:
Sequence, based on SEQRES records: (download)
>d1x2ha2 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]} stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss wewnfg
>d1x2ha2 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]} stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakrvtnl tellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqsswewnfg
Timeline for d1x2ha2:
![]() Domains from other chains: (mouse over for more information) d1x2hb1, d1x2hb2, d1x2hc1, d1x2hc2 |