| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
| Family d.104.1.3: LplA-like [143642] (6 proteins) part of Pfam PF03099 |
| Protein Two-domain LplA, N-terminal domain [160607] (1 species) |
| Species Escherichia coli [TaxId:562] [160608] (5 PDB entries) Uniprot P32099 1-246 |
| Domain d1x2gc2: 1x2g C:1-246 [145845] Other proteins in same PDB: d1x2ga1, d1x2gb1, d1x2gc1 automated match to d1x2ga2 |
PDB Entry: 1x2g (more details), 2.4 Å
SCOPe Domain Sequences for d1x2gc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x2gc2 d.104.1.3 (C:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
wewnfg
Timeline for d1x2gc2:
View in 3DDomains from other chains: (mouse over for more information) d1x2ga1, d1x2ga2, d1x2gb1, d1x2gb2 |