SCOPe 2.08: Domain d1x2gc2: 1x2g C:1-246

Lineage for d1x2gc2 (1x2g C:1-246)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.3: LplA-like [143642] (6 proteins)
   part of Pfam PF03099

6. Protein Two-domain LplA, N-terminal domain [160607] (1 species)

7. Species Escherichia coli [TaxId:562] [160608] (5 PDB entries)
   Uniprot P32099 1-246

8. Domain d1x2gc2: 1x2g C:1-246 [145845]
   Other proteins in same PDB: d1x2ga1, d1x2gb1, d1x2gc1
   automated match to d1x2ga2

Details for d1x2gc2

PDB Entry: 1x2g, 2.4 Å

PDB Description: Crystal Structure of Lipate-Protein Ligase A from Escherichia coli

PDB Compounds: (C:) Lipoate-protein ligase A

SCOPe Domain Sequences for d1x2gc2:

Sequence; same for both SEQRES and ATOM records:

>d1x2gc2 d.104.1.3 (C:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
wewnfg

Timeline for d1x2gc2:

• d1x2gc2 first appeared in SCOP 1.75
  
• d1x2gc2 appears in SCOPe 2.07