Lineage for d1x2ga2 (1x2g A:1-246)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. Family d.104.1.3: LplA-like [143642] (6 proteins)
    part of Pfam PF03099
  6. Protein Two-domain LplA, N-terminal domain [160607] (1 species)
  7. Species Escherichia coli [TaxId:562] [160608] (5 PDB entries)
    Uniprot P32099 1-246
  8. Domain d1x2ga2: 1x2g A:1-246 [145841]
    Other proteins in same PDB: d1x2ga1, d1x2gb1, d1x2gc1

Details for d1x2ga2

PDB Entry: 1x2g (more details), 2.4 Å

PDB Description: Crystal Structure of Lipate-Protein Ligase A from Escherichia coli
PDB Compounds: (A:) Lipoate-protein ligase A

SCOPe Domain Sequences for d1x2ga2:

Sequence, based on SEQRES records: (download)

>d1x2ga2 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
wewnfg

Sequence, based on observed residues (ATOM records): (download)

>d1x2ga2 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgrvtn
ltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqsswewnfg

SCOPe Domain Coordinates for d1x2ga2 are not available.

Timeline for d1x2ga2:

Domains from same chain:
(mouse over for more information)
d1x2ga1
Domains from other chains:
(mouse over for more information)
d1x2gb1, d1x2gb2, d1x2gc1, d1x2gc2