Class a: All alpha proteins [46456] (285 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (24 species) not a true protein |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [254957] (1 PDB entry) |
Domain d1x02a_: 1x02 A: [145839] automated match to d2mysb_ complexed with ca |
PDB Entry: 1x02 (more details)
SCOPe Domain Sequences for d1x02a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x02a_ a.39.1.0 (A:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn gtidfpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdee vdemireadidgdgqvnyeefvqmmtak
Timeline for d1x02a_: