Lineage for d1wspb1 (1wsp B:750-832)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 854088Family d.15.1.8: DIX domain [159926] (1 protein)
    Pfam PF00778
  6. 854089Protein Axin 1 [159927] (1 species)
  7. 854090Species Rat (Rattus norvegicus) [TaxId:10116] [159928] (2 PDB entries)
    Uniprot O70239 745-827
  8. 854092Domain d1wspb1: 1wsp B:750-832 [145835]
    automatically matched to 1WSP A:750-832
    complexed with bez, hg

Details for d1wspb1

PDB Entry: 1wsp (more details), 2.9 Å

PDB Description: Crystal structure of axin dix domain
PDB Compounds: (B:) Axin 1 protein

SCOP Domain Sequences for d1wspb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wspb1 d.15.1.8 (B:750-832) Axin 1 {Rat (Rattus norvegicus) [TaxId: 10116]}
cdsivvayyfcgepipyrtlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfee
vredeailpvfeekiigkvekvd

SCOP Domain Coordinates for d1wspb1:

Click to download the PDB-style file with coordinates for d1wspb1.
(The format of our PDB-style files is described here.)

Timeline for d1wspb1: