Lineage for d1wspa1 (1wsp A:750-832)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.8: DIX domain [159926] (2 proteins)
    Pfam PF00778
  6. Protein Axin 1 [159927] (1 species)
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [159928] (2 PDB entries)
    Uniprot O70239 745-827
  8. Domain d1wspa1: 1wsp A:750-832 [145834]
    complexed with bez, hg

Details for d1wspa1

PDB Entry: 1wsp (more details), 2.9 Å

PDB Description: Crystal structure of axin dix domain
PDB Compounds: (A:) Axin 1 protein

SCOPe Domain Sequences for d1wspa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wspa1 d.15.1.8 (A:750-832) Axin 1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cdsivvayyfcgepipyrtlvrgravtlgqfkelltkkgsyryyfkkvsdefdcgvvfee
vredeailpvfeekiigkvekvd

SCOPe Domain Coordinates for d1wspa1 are not available.

Timeline for d1wspa1:

Domains from other chains:
(mouse over for more information)
d1wspb_, d1wspc_