Class b: All beta proteins [48724] (174 folds) |
Fold b.106: Phage tail proteins [69278] (1 superfamily) core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel |
Superfamily b.106.1: Phage tail proteins [69279] (3 families) |
Family b.106.1.1: Baseplate protein-like [69280] (3 proteins) duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions |
Protein Baseplate protein gpP [159179] (3 species) 43 kda tail protein; Pfam PF06893 |
Species Bacteriophage mu [TaxId:10677] [159181] (1 PDB entry) Uniprot P08558 177-346! Uniprot P08558 3-176 |
Domain d1wrua1: 1wru A:177-346 [145831] |
PDB Entry: 1wru (more details), 2.1 Å
SCOP Domain Sequences for d1wrua1:
Sequence, based on SEQRES records: (download)
>d1wrua1 b.106.1.1 (A:177-346) Baseplate protein gpP {Bacteriophage mu [TaxId: 10677]} aastatdelvlgenlltldfeedfrdrfseytvkgyarangaegddidaksivsrkgtat dsdvtryrpmiiiadskitakdaqaralreqrrrlaksitfeaeidgwtrkdgqlwmpnl lvtidaskyaikttellvskvtlilndqdglktrvslapregflvpvesd
>d1wrua1 b.106.1.1 (A:177-346) Baseplate protein gpP {Bacteriophage mu [TaxId: 10677]} aastatdelvlgenlltldfeedfrdrfseytvksrkgtatdsdvtryrpmiiiadskit akdaqaralreqrrrlaksitfeaeidgwtrkdgqlwmpnllvtidaskyaikttellvs kvtlilndqdglktrvslapregflvpvesd
Timeline for d1wrua1: