SCOP 1.75: Domain d1wrua1: 1wru A:177-346

Lineage for d1wrua1 (1wru A:177-346)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.106: Phage tail proteins [69278] (1 superfamily)
   core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel

4. Superfamily b.106.1: Phage tail proteins [69279] (3 families)

5. Family b.106.1.1: Baseplate protein-like [69280] (3 proteins)
   duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions

6. Protein Baseplate protein gpP [159179] (3 species)
   43 kda tail protein; Pfam PF06893

7. Species Bacteriophage mu [TaxId:10677] [159181] (1 PDB entry)
   Uniprot P08558 177-346! Uniprot P08558 3-176

8. Domain d1wrua1: 1wru A:177-346 [145831]

Details for d1wrua1

PDB Entry: 1wru, 2.1 Å

PDB Description: Structure of central hub elucidated by X-ray analysis of gene product 44; baseplate component of bacteriophage Mu

PDB Compounds: (A:) 43 kDa tail protein

SCOP Domain Sequences for d1wrua1:

Sequence, based on SEQRES records:

>d1wrua1 b.106.1.1 (A:177-346) Baseplate protein gpP {Bacteriophage mu [TaxId: 10677]}
aastatdelvlgenlltldfeedfrdrfseytvkgyarangaegddidaksivsrkgtat
dsdvtryrpmiiiadskitakdaqaralreqrrrlaksitfeaeidgwtrkdgqlwmpnl
lvtidaskyaikttellvskvtlilndqdglktrvslapregflvpvesd

Sequence, based on observed residues (ATOM records):

>d1wrua1 b.106.1.1 (A:177-346) Baseplate protein gpP {Bacteriophage mu [TaxId: 10677]}
aastatdelvlgenlltldfeedfrdrfseytvksrkgtatdsdvtryrpmiiiadskit
akdaqaralreqrrrlaksitfeaeidgwtrkdgqlwmpnllvtidaskyaikttellvs
kvtlilndqdglktrvslapregflvpvesd

Timeline for d1wrua1:

• d1wrua1 is new in SCOP 1.75
  
• d1wrua1 appears in SCOPe 2.01
  
• d1wrua1 appears in the current release, SCOPe 2.08