Lineage for d1wrlf_ (1wrl F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711250Species Human (Homo sapiens) [TaxId:9606] [186813] (11 PDB entries)
  8. 2711263Domain d1wrlf_: 1wrl F: [145830]
    automated match to d1ap4a_
    complexed with ca, tfp

Details for d1wrlf_

PDB Entry: 1wrl (more details), 2.6 Å

PDB Description: crystal structure of the n-terminal domain of human cardiac troponin c in complex with trifluoperazine (monoclinic crystal form)
PDB Compounds: (F:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d1wrlf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wrlf_ a.39.1.5 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemid
evdedgsgtvdfdeflvmmvrs

SCOPe Domain Coordinates for d1wrlf_:

Click to download the PDB-style file with coordinates for d1wrlf_.
(The format of our PDB-style files is described here.)

Timeline for d1wrlf_: