![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein automated matches [190064] (21 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186813] (11 PDB entries) |
![]() | Domain d1wrle_: 1wrl E: [145829] automated match to d1ap4a_ complexed with ca, tfp |
PDB Entry: 1wrl (more details), 2.6 Å
SCOPe Domain Sequences for d1wrle_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wrle_ a.39.1.5 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} diykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemid evdedgsgtvdfdeflvmmvrsm
Timeline for d1wrle_: