![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies) core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta |
![]() | Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families) ![]() automatically mapped to Pfam PF01765 |
![]() | Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins) |
![]() | Protein automated matches [190814] (1 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [188088] (2 PDB entries) |
![]() | Domain d1wqga_: 1wqg A: [145821] automated match to d1wqfa1 complexed with cd |
PDB Entry: 1wqg (more details), 2.15 Å
SCOPe Domain Sequences for d1wqga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wqga_ d.67.3.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} idealfdaeekmekavavarddlstirtgranpgmfsritidyygaatpitqlasinvpe arlvvikpyeanqlraietairnsdlgvnptndgalirvavpqlteerrrelvkqakhkg eeakvsvrnirrkameelhrirkegeagedevgraekdldktthqyvtqidelvkhkege llev
Timeline for d1wqga_: