Lineage for d1wg3a1 (1wg3 A:8-167)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1771342Superfamily b.1.22: ASF1-like [101546] (1 family) (S)
    contains extra C-terminal strand
    automatically mapped to Pfam PF04729
  5. 1771343Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 1771344Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 1771345Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101549] (3 PDB entries)
  8. 1771348Domain d1wg3a1: 1wg3 A:8-167 [145819]

Details for d1wg3a1

PDB Entry: 1wg3 (more details), 3 Å

PDB Description: Structural analysis of yeast nucleosome-assembly factor CIA1p
PDB Compounds: (A:) Anti-silencing protein 1

SCOPe Domain Sequences for d1wg3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wg3a1 b.1.22.1 (A:8-167) Anti-silencing protein 1, ASF1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsi
lvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydee
elrenppakvqvdhivrnilaekprvtrfnivwdnenegd

SCOPe Domain Coordinates for d1wg3a1:

Click to download the PDB-style file with coordinates for d1wg3a1.
(The format of our PDB-style files is described here.)

Timeline for d1wg3a1: