Lineage for d1w7ca2 (1w7c A:43-169)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1640316Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1640510Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1640511Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1640763Protein Lysyl oxidase PplO, domains 1 and 2 [102806] (1 species)
  7. 1640764Species Yeast (Pichia pastoris) [TaxId:4922] [102807] (3 PDB entries)
    Uniprot Q96X16 43-777
  8. 1640765Domain d1w7ca2: 1w7c A:43-169 [145815]
    Other proteins in same PDB: d1w7ca1
    automated match to d1rkya2
    complexed with ca, cl, cu, imd, mg, nag

Details for d1w7ca2

PDB Entry: 1w7c (more details), 1.23 Å

PDB Description: pplo at 1.23 angstroms
PDB Compounds: (A:) lysyl oxidase

SCOPe Domain Sequences for d1w7ca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7ca2 d.17.2.1 (A:43-169) Lysyl oxidase PplO, domains 1 and 2 {Yeast (Pichia pastoris) [TaxId: 4922]}
aecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwietlk
pnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyntn
gksklpf

SCOPe Domain Coordinates for d1w7ca2:

Click to download the PDB-style file with coordinates for d1w7ca2.
(The format of our PDB-style files is described here.)

Timeline for d1w7ca2: