| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) ![]() |
| Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
| Protein Lysyl oxidase PplO, domains 1 and 2 [102806] (1 species) |
| Species Yeast (Pichia pastoris) [TaxId:4922] [102807] (3 PDB entries) Uniprot Q96X16 43-777 |
| Domain d1w7ca2: 1w7c A:43-169 [145815] Other proteins in same PDB: d1w7ca1 automated match to d1rkya2 complexed with ca, cl, cu, imd, mg, nag |
PDB Entry: 1w7c (more details), 1.23 Å
SCOPe Domain Sequences for d1w7ca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w7ca2 d.17.2.1 (A:43-169) Lysyl oxidase PplO, domains 1 and 2 {Yeast (Pichia pastoris) [TaxId: 4922]}
aecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwietlk
pnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyntn
gksklpf
Timeline for d1w7ca2: