Lineage for d1w7ca1 (1w7c A:316-779)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2052444Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2052445Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2052446Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 2052575Protein Lysyl oxidase PplO, domain 3 [101663] (1 species)
  7. 2052576Species Yeast (Pichia pastoris) [TaxId:4922] [101664] (3 PDB entries)
    Uniprot Q96X16 43-777
  8. 2052577Domain d1w7ca1: 1w7c A:316-779 [145814]
    Other proteins in same PDB: d1w7ca2, d1w7ca3
    automated match to d1rkya1
    complexed with ca, cl, cu, imd, mg, nag

Details for d1w7ca1

PDB Entry: 1w7c (more details), 1.23 Å

PDB Description: pplo at 1.23 angstroms
PDB Compounds: (A:) lysyl oxidase

SCOPe Domain Sequences for d1w7ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7ca1 b.30.2.1 (A:316-779) Lysyl oxidase PplO, domain 3 {Yeast (Pichia pastoris) [TaxId: 4922]}
hlddrksprlvepegrrwaydgdeeyfswmdwgfytswsrdtgisfyditfkgerivyel
slqeliaeygsddpfnqhtfysdisygvgnrfslvpgydcpstagyfttdtfeydefynr
tlsycvfenqedysllrhtgasysaitqnptlnvrfistignydynflykffldgtlevs
vraagyiqagywnpetsapyglkihdvlsgsfhdhvlnykvdldvggtknrasqyvmkdv
dveypwapgtvyntkqiarevfenedfnginwpengqgilliesaeetnsfgnpraynim
pggggvhrivknsrsgpetqnwarsnlfltkhkdtelrsstalntnalydppvnfnafld
desldgedivawvnlglhhlpnsndlpntifstahasfmltpfnyfdsensrdttqqvfy
tyddeteesnwefygndwsscgvevaepnfedytygrgtrinkk

SCOPe Domain Coordinates for d1w7ca1:

Click to download the PDB-style file with coordinates for d1w7ca1.
(The format of our PDB-style files is described here.)

Timeline for d1w7ca1: