Lineage for d1w42a1 (1w42 A:1-99)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566728Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2566729Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2566730Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species)
  7. 2566737Species Thermococcus celer [TaxId:2264] [89986] (8 PDB entries)
  8. 2566741Domain d1w42a1: 1w42 A:1-99 [145813]

Details for d1w42a1

PDB Entry: 1w42 (more details), 1.8 Å

PDB Description: t. celer l30e r92a variant
PDB Compounds: (A:) 50s ribosomal protein l30e

SCOPe Domain Sequences for d1w42a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w42a1 d.79.3.1 (A:1-99) Eukaryotic ribosomal protein L30 (L30e) {Thermococcus celer [TaxId: 2264]}
vdfafelrkaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgipv
yefegtsvelgtllgrphtvsalavvdpgesailalggk

SCOPe Domain Coordinates for d1w42a1:

Click to download the PDB-style file with coordinates for d1w42a1.
(The format of our PDB-style files is described here.)

Timeline for d1w42a1: