Lineage for d1w40a1 (1w40 A:1-97)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960097Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2960098Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2960099Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species)
  7. 2960106Species Thermococcus celer [TaxId:2264] [89986] (8 PDB entries)
  8. 2960111Domain d1w40a1: 1w40 A:1-97 [145811]

Details for d1w40a1

PDB Entry: 1w40 (more details), 2.03 Å

PDB Description: t. celer l30e k9a variant
PDB Compounds: (A:) 50s ribosomal protein l30e

SCOPe Domain Sequences for d1w40a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w40a1 d.79.3.1 (A:1-97) Eukaryotic ribosomal protein L30 (L30e) {Thermococcus celer [TaxId: 2264]}
vdfafelraaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgipv
yefegtsvelgtllgrphtvsalavvdpgesrilalg

SCOPe Domain Coordinates for d1w40a1:

Click to download the PDB-style file with coordinates for d1w40a1.
(The format of our PDB-style files is described here.)

Timeline for d1w40a1: