![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (4 families) ![]() |
![]() | Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
![]() | Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species) |
![]() | Species Thermococcus celer [TaxId:2264] [89986] (8 PDB entries) |
![]() | Domain d1w40a1: 1w40 A:1-97 [145811] |
PDB Entry: 1w40 (more details), 2.03 Å
SCOPe Domain Sequences for d1w40a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w40a1 d.79.3.1 (A:1-97) Eukaryotic ribosomal protein L30 (L30e) {Thermococcus celer [TaxId: 2264]} vdfafelraaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgipv yefegtsvelgtllgrphtvsalavvdpgesrilalg
Timeline for d1w40a1: