Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (3 families) |
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species) |
Species Thermococcus celer [TaxId:2264] [89986] (8 PDB entries) |
Domain d1w3ex1: 1w3e X:1-98 [145810] mutant |
PDB Entry: 1w3e (more details), 1.77 Å
SCOPe Domain Sequences for d1w3ex1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Thermococcus celer [TaxId: 2264]} vdfafelrkaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgiav yefegtsvelgtllgrphtvsalavvdpgesrilalgg
Timeline for d1w3ex1: