Lineage for d1w3ex1 (1w3e X:1-98)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1209532Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1209834Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 1209835Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 1209836Protein Eukaryotic ribosomal protein L30 (L30e) [55317] (2 species)
  7. 1209843Species Thermococcus celer [TaxId:2264] [89986] (8 PDB entries)
  8. 1209846Domain d1w3ex1: 1w3e X:1-98 [145810]
    mutant

Details for d1w3ex1

PDB Entry: 1w3e (more details), 1.77 Å

PDB Description: ribosomal l30e of thermococcus celer, p59a mutant
PDB Compounds: (X:) 50s ribosomal protein l30e

SCOPe Domain Sequences for d1w3ex1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Thermococcus celer [TaxId: 2264]}
vdfafelrkaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyarlsgiav
yefegtsvelgtllgrphtvsalavvdpgesrilalgg

SCOPe Domain Coordinates for d1w3ex1:

Click to download the PDB-style file with coordinates for d1w3ex1.
(The format of our PDB-style files is described here.)

Timeline for d1w3ex1: