![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50587] (79 PDB entries) Uniprot P00749 156-178,179-424 |
![]() | Domain d1w14u_: 1w14 U: [145809] automated match to d1ejna_ complexed with sh1, so4 |
PDB Entry: 1w14 (more details), 2.2 Å
SCOPe Domain Sequences for d1w14u_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w14u_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw irshtke
Timeline for d1w14u_: