Lineage for d1vsqb1 (1vsq B:2-130)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171202Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 1171203Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) (S)
    active dimer is formed by strand 5 swapping
  5. 1171204Family c.54.1.1: EIIA-man component-like [53063] (2 proteins)
  6. 1171205Protein IIA domain of mannose transporter, IIA-Man [53064] (1 species)
  7. 1171206Species Escherichia coli [TaxId:562] [53065] (4 PDB entries)
  8. 1171209Domain d1vsqb1: 1vsq B:2-130 [145803]
    automatically matched to d1pdoa_

Details for d1vsqb1

PDB Entry: 1vsq (more details)

PDB Description: solution nmr structure of the productive complex between iiamannose and iibmannose of the mannose transporter of the e. coli phosphotransferase system
PDB Compounds: (B:) Mannose-specific phosphotransferase enzyme IIA component

SCOPe Domain Sequences for d1vsqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsqb1 c.54.1.1 (B:2-130) IIA domain of mannose transporter, IIA-Man {Escherichia coli [TaxId: 562]}
tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
gregvkalk

SCOPe Domain Coordinates for d1vsqb1:

Click to download the PDB-style file with coordinates for d1vsqb1.
(The format of our PDB-style files is described here.)

Timeline for d1vsqb1: