Lineage for d1vspz1 (1vsp Z:1-48)

  1. Root: SCOPe 2.07
  2. 2650239Class j: Peptides [58231] (148 folds)
  3. 2652055Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
    non-globular, mainly alpha-helical
  4. 2652056Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) (S)
  5. 2652057Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
    Pfam PF00468
  6. 2652058Protein Ribosomal protein L34p [144323] (3 species)
  7. 2652075Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries)
    Uniprot P80340 1-49
  8. 2652084Domain d1vspz1: 1vsp Z:1-48 [145801]
    Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspo1, d1vspp1, d1vsps1, d1vspt1

Details for d1vspz1

PDB Entry: 1vsp (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 1VSP, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2QNH
PDB Compounds: (Z:) 50S ribosomal protein L34

SCOPe Domain Sequences for d1vspz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vspz1 j.118.1.1 (Z:1-48) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrk

SCOPe Domain Coordinates for d1vspz1:

Click to download the PDB-style file with coordinates for d1vspz1.
(The format of our PDB-style files is described here.)

Timeline for d1vspz1: