SCOPe 2.03: Domain d1vspz1: 1vsp Z:1-48

Lineage for d1vspz1 (1vsp Z:1-48)

1. Root: SCOPe 2.03

2. Class j: Peptides [58231] (120 folds)

3. Fold j.118: Ribosomal protein L34p [144320] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family)

5. Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein)
   Pfam PF00468

6. Protein Ribosomal protein L34p [144323] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries)
   Uniprot P80340 1-49

8. Domain d1vspz1: 1vsp Z:1-48 [145801]
   Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspo1, d1vspp1, d1vsps1, d1vspt1
   automatically matched to 2J01 7:1-49

Details for d1vspz1

PDB Entry: 1vsp, 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 1VSP, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2QNH

PDB Compounds: (Z:) 50S ribosomal protein L34

SCOPe Domain Sequences for d1vspz1:

Sequence; same for both SEQRES and ATOM records:

>d1vspz1 j.118.1.1 (Z:1-48) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]}
mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrk

Timeline for d1vspz1:

• d1vspz1 first appeared in SCOP 1.75
  
• d1vspz1 appears in SCOPe 2.02
  
• d1vspz1 appears in SCOPe 2.04
  
• d1vspz1 appears in the current release, SCOPe 2.08