![]() | Class j: Peptides [58231] (120 folds) |
![]() | Fold j.118: Ribosomal protein L34p [144320] (1 superfamily) non-globular, mainly alpha-helical |
![]() | Superfamily j.118.1: Ribosomal protein L34p [144321] (1 family) ![]() |
![]() | Family j.118.1.1: Ribosomal protein L34p [144322] (1 protein) Pfam PF00468 |
![]() | Protein Ribosomal protein L34p [144323] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [161306] (15 PDB entries) Uniprot P80340 1-49 |
![]() | Domain d1vspz1: 1vsp Z:1-48 [145801] Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspo1, d1vspp1, d1vsps1, d1vspt1 automatically matched to 2J01 7:1-49 |
PDB Entry: 1vsp (more details), 3.83 Å
SCOPe Domain Sequences for d1vspz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vspz1 j.118.1.1 (Z:1-48) Ribosomal protein L34p {Thermus thermophilus [TaxId: 274]} mkrtwqpnrrkrakthgfrarmrtpggrkvlkrrrqkgrwrltpavrk
Timeline for d1vspz1: