![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
![]() | Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) ![]() |
![]() | Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
![]() | Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species) contains additional all-beta (sub)domain in the C-terminal extension |
![]() | Species Thermus thermophilus [TaxId:274] [63799] (16 PDB entries) |
![]() | Domain d1vspt1: 1vsp T:3-179 [145800] Other proteins in same PDB: d1vspa1, d1vspc1, d1vspf1, d1vspf2, d1vspi1, d1vspj1, d1vspo1, d1vspp1, d1vsps1, d1vspz1 |
PDB Entry: 1vsp (more details), 3.83 Å
SCOPe Domain Sequences for d1vspt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vspt1 b.53.1.1 (T:3-179) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]} yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped
Timeline for d1vspt1: